| Transcript | Ll_transcript_393196 |
|---|---|
| CDS coordinates | 44-334 (+) |
| Peptide sequence | MSDSKVDEKLDAGDKEKLKAEIDKTVTWLDDNQTATKDEYESQQKELEGIANPIMMKFYGAGGEGGMPGGMPGGGMPGGAPGGAGGDDGPTVEEVD* |
| ORF Type | complete |
| Blastp | Heat shock 70 kDa protein from Alternaria alternata group with 93.75% of identity |
|---|---|
| Blastx | Heat shock 70 kDa protein from Alternaria alternata group with 93.15% of identity |
| Eggnog | - |
| Kegg | - |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_015968060.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer