| Transcript | Ll_transcript_393199 |
|---|---|
| CDS coordinates | 3-404 (+) |
| Peptide sequence | ERMLAEAEKYKAEDEAEAARIAAKNALESYAYSLRNTLSDSKVDEKLDAGDKEKLKAEIDKTVTWLDDNQTATKDEYESQQKELEGIANPIMMKFYGAGGEGGMPGGMPGGGMPGGAPGGAGGDDGPTVEEVD* |
| ORF Type | 5prime_partial |
| Blastp | Heat shock 70 kDa protein from Alternaria alternata group with 95.49% of identity |
|---|---|
| Blastx | Heat shock 70 kDa protein from Alternaria alternata group with 94.12% of identity |
| Eggnog | - |
| Kegg | - |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_015968060.1) |
| Pfam | Hsp70 protein (PF00012.19) |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer