Protein coding transcript 181532

• Transcript: Ll_transcript_237716
• CDS coordinates: 1-546 (+)
• Peptide sequence: MRDNGFDRSPTMCTDKWRNLLKEFKKAKHQDNCGNAKMSFYKEIDHILRERVKNLQYNTPKVDTFMHFLQKGVEDTSISFLPVEGTGRPTLNLERSLDHDGHPLAITTAEAVAASGVPPWNWRETPENAGGESQSCCGRVISVKWGDYTRRIGIDGTAEAIKEAIRSAFRLRTRRAFWLEDE
• ORF Type: 3prime_partial

Annotations of Ll_transcript_237716

• Blastp: Trihelix transcription factor GT-1 from Arabidopsis with 71.43% of identity
• Blastx: Trihelix transcription factor GT-1 from Arabidopsis with 71.43% of identity
• Eggnog: DNA binding protein GT-1(ENOG410XUBM)
• Kegg: Link to kegg annotations (AT1G13450)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019438321.1)
• Pfam: Myb/SANT-like DNA-binding domain (PF13837.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;