Transcript | Ll_transcript_238355 |
---|---|
CDS coordinates | 109-438 (+) |
Peptide sequence | MATTVASAPDPAPANNNTENHKKNRIQVSNTKKPLFFYVNLAKRYIQQHDEVELSALGMAITTVVTIAEILKNNGLATEKKVLTSTVGMKDENKGRLVQKAKASLNIKF* |
ORF Type | complete |
Blastp | Uncharacterized protein At2g34160 from Arabidopsis with 72.22% of identity |
---|---|
Blastx | Uncharacterized protein At2g34160 from Arabidopsis with 72.22% of identity |
Eggnog | Alba(ENOG41121TC) |
Kegg | Link to kegg annotations (AT2G34160) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019453766.1) |
Pfam | Alba (PF01918.20) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer