Protein coding transcript 181583

• Transcript: Ll_transcript_238355
• CDS coordinates: 109-438 (+)
• Peptide sequence: MATTVASAPDPAPANNNTENHKKNRIQVSNTKKPLFFYVNLAKRYIQQHDEVELSALGMAITTVVTIAEILKNNGLATEKKVLTSTVGMKDENKGRLVQKAKASLNIKF*
• ORF Type: complete

Annotations of Ll_transcript_238355

• Blastp: Uncharacterized protein At2g34160 from Arabidopsis with 72.22% of identity
• Blastx: Uncharacterized protein At2g34160 from Arabidopsis with 72.22% of identity
• Eggnog: Alba(ENOG41121TC)
• Kegg: Link to kegg annotations (AT2G34160)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019453766.1)
• Pfam: Alba (PF01918.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;