Transcript | Ll_transcript_237263 |
---|---|
CDS coordinates | 288-854 (+) |
Peptide sequence | MKTTMRRDKDGEILWQLIFCNREGFRERKDDVVRKSAPRKESRCECLGRMKIHADKEKGDWYISYFSDEHNHELLGEHYGGMIASNRKMAEADVGQMNTMRELGIGTGNFFGSFASQCGGYRYIGFTKKDMYNQIHKQRQIGKGDAEATLHYLKEQSRSYCTMYWRHTMDEDGRLQQLFSKAQMVIIL* |
ORF Type | complete |
Blastp | Protein FAR1-RELATED SEQUENCE 5 from Arabidopsis with 25% of identity |
---|---|
Blastx | Serine/threonine-protein phosphatase 7 long form homolog from Arabidopsis with 39.65% of identity |
Eggnog | protein FAR1-RELATED SEQUENCE 5-like(ENOG410ZJSX) |
Kegg | Link to kegg annotations (AT4G38180) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019416721.1) |
Pfam | FAR1 DNA-binding domain (PF03101.14) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer