Protein coding transcript 181624

• Transcript: Ll_transcript_237282
• CDS coordinates: 145-894 (+)
• Peptide sequence: MNILSPPQLHINKPYHFTHPHGTFKKQFHSNRNRNVLQRSSPFTVLCNSKPNEDDFVSRVLKENPSQVQPKFLIGEKFYNLKEKQDFGKKSNVGIFDVLKRLKPLRKSDNVEQNKDLEEKKDSVYLKDLLKEYRGNLYVPEHIFGTKLSEEEEFDKNLDSCPKMSIEEFLKALSKDKIKLITSKGDNGSYFRDFIVELKEIPGDKSLHTTKWVLRLDKNEAQAILEDYTGPRYEIERHTTVVNLYLCNT*
• ORF Type: complete

Annotations of Ll_transcript_237282

• Blastp: Probable inactive ATP-dependent zinc metalloprotease FTSHI 1, chloroplastic from Arabidopsis with 49.58% of identity
• Blastx: Probable inactive ATP-dependent zinc metalloprotease FTSHI 1, chloroplastic from Arabidopsis with 46.62% of identity
• Eggnog: Acts as a processive, ATP-dependent zinc metallopeptidase for both cytoplasmic and membrane proteins. Plays a role in the quality control of integral membrane proteins (By similarity)(COG0465)
• Kegg: Link to kegg annotations (AT4G23940)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019423765.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;