Protein coding transcript 181672

• Transcript: Ll_transcript_239216
• CDS coordinates: 1-345 (+)
• Peptide sequence: DIYGTVDFIFGNAAVVFQKCNIYARKPLPNQKNSITAQGRNDPNQVTGISIQNCKINAAPDLAAEINSTENYLGRPWKQYSRTVYLQSYIGDLIHPLGWLEWNGTVGLDTLFLW*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_239216

• Blastp: Probable pectinesterase/pectinesterase inhibitor 47 from Arabidopsis with 73.87% of identity
• Blastx: Probable pectinesterase/pectinesterase inhibitor 47 from Arabidopsis with 73.87% of identity
• Eggnog: pectinesterase(COG4677)
• Kegg: Link to kegg annotations (AT5G04970)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019450515.1)
• Pfam: Pectinesterase (PF01095.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;