| Transcript | Ll_transcript_237486 |
|---|---|
| CDS coordinates | 470-769 (+) |
| Peptide sequence | MEIESGKLSSSGFVLLDCPQSMKIESSHASLVGSISDYFLSLSNGWDLTSYLKSLSKALRALKLSSCLSTNPTEGSNSSCMVSGLFFGLILWIEWSLCS* |
| ORF Type | complete |
| Blastp | Mediator of RNA polymerase II transcription subunit 13 from Arabidopsis with 73.17% of identity |
|---|---|
| Blastx | Mediator of RNA polymerase II transcription subunit 13 from Arabidopsis with 74.47% of identity |
| Eggnog | - |
| Kegg | Link to kegg annotations (AT1G55325) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019438262.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer