Protein coding transcript 181865

• Transcript: Ll_transcript_236501
• CDS coordinates: 181-540 (+)
• Peptide sequence: MMFFGCVNCSAIFVNKKYFYLHLDSSEEGSAQFNPRNRFVVFILTMFTLITLYSTIIPISLYVSIEMIKFIQSTQFINKDLCMYHNETNTPALARTSNLNEELGQVEYIFSDKTGTLTRN
• ORF Type: 3prime_partial

Annotations of Ll_transcript_236501

• Blastp: Phospholipid-transporting ATPase 3 from Arabidopsis with 65.83% of identity
• Blastx: Phospholipid-transporting ATPase 3 from Arabidopsis with 63.71% of identity
• Eggnog: Phospholipid-transporting atpase(ENOG410XPYK)
• Kegg: Link to kegg annotations (AT1G59820)
• CantataDB: Link to cantataDB annotations (CNT0000254)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_014626219.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;