Protein coding transcript 181868

• Transcript: Ll_transcript_236505
• CDS coordinates: 2-448 (+)
• Peptide sequence: MNTMNVPSKRSTLERKLDKLILALFATLFMMCFIGAIGSAIFVNKKYFYLHLDSSEEGSAQFNPRNRFVVFILTMFTLITLYSTIIPISLYVSIEMIKFIQSTQFINKDLCMYHNETNTPALARTSNLNEELGQVEYIFSDKTGTLTRN
• ORF Type: 3prime_partial

Annotations of Ll_transcript_236505

• Blastp: Phospholipid-transporting ATPase 3 from Arabidopsis with 68.46% of identity
• Blastx: Phospholipid-transporting ATPase 3 from Arabidopsis with 68.46% of identity
• Eggnog: Phospholipid-transporting atpase(ENOG410XPYK)
• Kegg: Link to kegg annotations (AT1G59820)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019431016.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;