Transcript | Ll_transcript_236505 |
---|---|
CDS coordinates | 2-448 (+) |
Peptide sequence | MNTMNVPSKRSTLERKLDKLILALFATLFMMCFIGAIGSAIFVNKKYFYLHLDSSEEGSAQFNPRNRFVVFILTMFTLITLYSTIIPISLYVSIEMIKFIQSTQFINKDLCMYHNETNTPALARTSNLNEELGQVEYIFSDKTGTLTRN |
ORF Type | 3prime_partial |
Blastp | Phospholipid-transporting ATPase 3 from Arabidopsis with 68.46% of identity |
---|---|
Blastx | Phospholipid-transporting ATPase 3 from Arabidopsis with 68.46% of identity |
Eggnog | Phospholipid-transporting atpase(ENOG410XPYK) |
Kegg | Link to kegg annotations (AT1G59820) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019431016.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer