Transcript | Ll_transcript_237531 |
---|---|
CDS coordinates | 211-1392 (+) |
Peptide sequence | MMKSMRNLVHGLKPALLMVVVQIANAWVNVMYKLAVNDGMSLRVVVAYRYIFATAFIAPLAFILERKTRPKLSWTILFQAFLCGLFGGALPQNLHMEALALTSVTFTTAVSNLIPAITFILSLLFGLETLNLRAAGGRAKMIGTITGIGGAMVLTFFKGVEIKMLSFHINLFNNKNSHVVHPQASSHGMFILGAFSSFASNISYALWLIIQAKMSQRYPCPYSSTALMSLMGALLSITFTFFLERDLSQWRLGWNVRLITVAYAGIVVSGVMVAVISWCVRTRGPLFVSVFSPLMLVVVAFAGSTILDEKLYLGSIIGSVLIVCGLYIVLWGKSKEMRKNIQSVSPNGHHDFKTVEVIVKSPVLDTASHENYNNTLHNIGGKEVISRNTGLNT* |
ORF Type | complete |
Blastp | WAT1-related protein At1g68170 from Arabidopsis with 46.35% of identity |
---|---|
Blastx | WAT1-related protein At1g68170 from Arabidopsis with 46.35% of identity |
Eggnog | auxin-induced protein 5NG4-like(ENOG410YFQG) |
Kegg | Link to kegg annotations (AT1G68170) |
CantataDB | Link to cantataDB annotations (CNT0001849) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019424689.1) |
Pfam | EamA-like transporter family (PF00892.19) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer