Protein coding transcript 181883

• Transcript: Ll_transcript_237532
• CDS coordinates: 211-1233 (+)
• Peptide sequence: MMKSMRNLVHGLKPALLMVVVQIANAWVNVMYKLAVNDGMSLRVVVAYRYIFATAFIAPLAFILERKTRPKLSWTILFQAFLCGLFGGALPQNLHMEALALTSVTFTTAVSNLIPAITFILSLLFGLETLNLRAAGGRAKMIGTITGIGGAMVLTFFKGVEIKMLSFHINLFNNKNSHVVHPQASSHGMFILGAFSSFASNISYALWLIIQAKMSQRYPCPYSSTALMSLMGALLSITFTFFLERDLSQWRLGWNVRLITVAYAGIVVSGVMVAVISWCVRTRGPLFVSVFSPLMLVVVAFAGSTILDEKLYLGRYKCTFYIIIISSVSLINIIFPIIKA*
• ORF Type: complete

Annotations of Ll_transcript_237532

• Blastp: WAT1-related protein At1g68170 from Arabidopsis with 46.15% of identity
• Blastx: WAT1-related protein At1g68170 from Arabidopsis with 46.86% of identity
• Eggnog: auxin-induced protein 5NG4-like(ENOG410YFQG)
• Kegg: Link to kegg annotations (AT1G68170)
• CantataDB: Link to cantataDB annotations (CNT0001849)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019424689.1)
• Pfam: EamA-like transporter family (PF00892.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;