Protein coding transcript 181884

• Transcript: Ll_transcript_237533
• CDS coordinates: 211-591 (+)
• Peptide sequence: MMKSMRNLVHGLKPALLMVVVQIANAWVNVMYKLAVNDGMSLRVVVAYRYIFATAFIAPLAFILERKTRPKLSWTILFQAFLCGLFGGALPQNLHMEALALTSVTFTTAVSNLIPAITFILSLLFG*
• ORF Type: complete

Annotations of Ll_transcript_237533

• Blastp: WAT1-related protein At5g07050 from Arabidopsis with 42.74% of identity
• Blastx: WAT1-related protein At1g68170 from Arabidopsis with 46.07% of identity
• Eggnog: Auxin-induced protein(ENOG410YD20)
• Kegg: Link to kegg annotations (AT5G07050)
• CantataDB: Link to cantataDB annotations (CNT0001849)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019424689.1)
• Pfam: EamA-like transporter family (PF00892.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;