Protein coding transcript 181901

• Transcript: Ll_transcript_237564
• CDS coordinates: 213-641 (-)
• Peptide sequence: MQECLMIVDLVVKRNGKYGFVIFYMNNEKLYKAIIKGCDEIIPKVIEPIRSTEIREGNVGLLFVVMILQDTRQSNPPQDQAKVAAYAHIKHNRRLASILVNEPTPFTPNLKAIIAPTTTFKKQNPSSKLVKLRRWKQDWQQH*
• ORF Type: complete

Annotations of Ll_transcript_237564

• Blastp: Protein LlR18A from Lupinus with 57.45% of identity
• Blastx: Sugar transport protein 11 from Arabidopsis with 43.75% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_004513818.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;