Protein coding transcript 181929

• Transcript: Ll_transcript_236353
• CDS coordinates: 1-957 (+)
• Peptide sequence: PLLPPPPPPNPYYYPPPPPPPPPGYYYNSTNPQSYYHSSSSHHPFYPNQHHQRGCTTLTPPTIPYVDHQTAKKIRNNVNLHKHTLSLQLDPLNPNHHLLSFVFDALSHGSITIFYLAKEEEQCRFIPLYPDAFEPITFPFQKGAGQKFCQPSGTGIDLGFFELDDLSKPSPQEDVFPLVICAETRAETASADENPSNSMLDSSPRMQITQAVLEKRNGSDPFQVKVVRQILWIDNVRYELRELYGIGGSTAADFDDTDPGKECVICMTEPKDTAVLPCRHMCMCSECAKALRLQSNKCPICRQAIEELIEIKISEGDQ*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_236353

• Blastp: Probable E3 ubiquitin-protein ligase LUL3 from Arabidopsis with 54.02% of identity
• Blastx: Probable E3 ubiquitin-protein ligase LUL3 from Arabidopsis with 59.25% of identity
• Eggnog: RING finger(ENOG410XRAE)
• Kegg: Link to kegg annotations (AT5G19080)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019437198.1)
• Pfam: Zinc finger, C3HC4 type (RING finger) (PF13920.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;