Protein coding transcript 181930

• Transcript: Ll_transcript_236362
• CDS coordinates: 1-375 (+)
• Peptide sequence: PLLPPPPPPNPYYYPPPPPPPPPGYYYNSTNPQSYYHSSSSHHPFYPNQHHQRGCTTLTPPTIPYVDHQTAKKIRNNVNLHKHTLSLQLDPLNPNHHLLSFVFDALSHGRYPSPPLSLSYLSLF*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_236362

• Blastp: Probable E3 ubiquitin-protein ligase LUL3 from Arabidopsis with 43.14% of identity
• Blastx: Probable E3 ubiquitin-protein ligase LUL3 from Arabidopsis with 55.56% of identity
• Eggnog: RING finger(ENOG410XRAE)
• Kegg: Link to kegg annotations (AT5G19080)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019437207.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;