Protein coding transcript 181959

• Transcript: Ll_transcript_238744
• CDS coordinates: 190-999 (+)
• Peptide sequence: MMAWFQQQLSSVDWEQESYPTFHDFSVVPFFALFFPTIRFILDTFLFEKVGRRLIFGNGHDMLDFQTDENRKKIRKFKESAWKCVYFLSAEFFALSVTYDEPWFTNTRYFWVGPGSQTWPDQKIKLKLKGLYMYAAGFYSYSILALIFWETRRSDFVVSMCHHVASIILIVLSYIFRFVRVGSIVLALHDATDVFLETGKMSIYSGAEKIASIAFIGFVLSWTILRLIYYPFWVLRSTRFVLAQLLVYIFSFYCQLGFQTRLECSCKSR*
• ORF Type: complete

Annotations of Ll_transcript_238744

• Blastp: ASC1-like protein from Lycopersicon with 70.21% of identity
• Blastx: ASC1-like protein from Lycopersicon with 70.21% of identity
• Eggnog: ceramide synthase(COG5058)
• Kegg: Link to kegg annotations (543781)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019461038.1)
• Pfam: TLC domain (PF03798.15)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;