Transcript | Ll_transcript_238774 |
---|---|
CDS coordinates | 1058-1807 (+) |
Peptide sequence | MLDFQTDENRKKIRKFKESAWKCVYFLSAEFFALSVTYDEPWFTNTRYFWVGPGSQTWPDQKIKLKLKGLYMYAAGFYSYSILALIFWETRRSDFVVSMCHHVASIILIVLSYIFRFVRVGSIVLALHDATDVFLETGKMSIYSGAEKIASIAFIGFVLSWTILRLIYYPFWVLRSTSYEVVFAFHNEKYRVHGPIYYYVFNTLLFSLLVLNIYWWVLMLRMLVKQVQSKGKVSEDIRSDSEDEHEHEE* |
ORF Type | complete |
Blastp | LAG1 longevity assurance homolog 3 from Arabidopsis with 74.69% of identity |
---|---|
Blastx | ASC1-like protein from Lycopersicon with 70.92% of identity |
Eggnog | ceramide synthase(COG5058) |
Kegg | Link to kegg annotations (AT1G13580) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019461038.1) |
Pfam | TLC domain (PF03798.15) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer