Protein coding transcript 181987

• Transcript: Ll_transcript_236790
• CDS coordinates: 3-395 (+)
• Peptide sequence: LIFSLSQIQTSTFKPYRLRVEMASKRITKELKDLQKDPPVSCSAGPVGEDLFHWQATIMGPADSPYSGGVFLVTIHFPPDYPFKPPKVSRPKLLAVYVLCYYIIIYKHIKYSTPISMHLEFWTKFRHFVL*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_236790

• Blastp: Ubiquitin-conjugating enzyme E2 5A from Oryza sativa with 91.18% of identity
• Blastx: Ubiquitin-conjugating enzyme E2 28 from Arabidopsis with 93.9% of identity
• Eggnog: ubiquitin-conjugating enzyme(COG5078)
• Kegg: Link to kegg annotations (4327162)
• CantataDB: Link to cantataDB annotations (CNT0002933)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019462151.1)
• Pfam: Ubiquitin-conjugating enzyme (PF00179.25)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;