Protein coding transcript 181988

• Transcript: Ll_transcript_236779
• CDS coordinates: 1141-1476 (+)
• Peptide sequence: MGPADSPYAGGVFLVTIHFPPDYPFKPPKVAFKTKVFHPNINNNGSICLDILKEQWSPALTVSKVLLSICSLLTDPNPDDPLVPDIAHMYKTDRNKYESTARSWTQKYAMN*
• ORF Type: complete

Annotations of Ll_transcript_236779

• Blastp: Ubiquitin-conjugating enzyme E2 10 from Arabidopsis with 92.79% of identity
• Blastx: Ubiquitin-conjugating enzyme E2 10 from Arabidopsis with 92.06% of identity
• Eggnog: ubiquitin-conjugating enzyme(COG5078)
• Kegg: Link to kegg annotations (AT5G53300)
• CantataDB: Link to cantataDB annotations (CNT0002933)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_013466022.1)
• Pfam: Ubiquitin-conjugating enzyme (PF00179.25)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;