Transcript | Ll_transcript_294545 |
---|---|
CDS coordinates | 38-562 (+) |
Peptide sequence | MGEEATQEHEMSIAAPLIFLIIAIFQFAYYWLDHLKKDGFDHAKETQINGEVKELLKEASSLSQPSTFAQAAKLRRLAASKEKELAKYRNLHSKDYVLYSKLLLISKYVAYIMLVLWFWRAPVAFIPRQLVQPFERLLSWRTTGPQNNNVMIGIISWLIVSARVCRFVRRAYSK* |
ORF Type | complete |
Blastp | Tail-anchored protein insertion receptor WRB from Danio with 25% of identity |
---|---|
Blastx | Tail-anchored protein insertion receptor WRB from Danio with 25% of identity |
Eggnog | Required for the post-translational delivery of tail- anchored (TA) proteins to the endoplasmic reticulum. Acts as a membrane receptor for soluble get3, which recognizes and selectively binds the transmembrane domain of TA proteins in the cytosol (By similarity)(ENOG41120B0) |
Kegg | Link to kegg annotations (335756) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019420872.1) |
Pfam | CHD5-like protein (PF04420.13) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer