Transcript | Ll_transcript_237832 |
---|---|
CDS coordinates | 265-567 (+) |
Peptide sequence | MGDKSEVLEAVLKEAVDLENIPIEEVFENLRCSKEGLTSQAAEERLVIFGHNKLEEKKESKFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFV |
ORF Type | 3prime_partial |
Blastp | ATPase 11, plasma membrane-type from Arabidopsis with 90.1% of identity |
---|---|
Blastx | ATPase 11, plasma membrane-type from Arabidopsis with 90.1% of identity |
Eggnog | P-type atpase(COG0474) |
Kegg | Link to kegg annotations (AT5G62670) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019437950.1) |
Pfam | Cation transporter/ATPase, N-terminus (PF00690.25) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer