Protein coding transcript 182080

• Transcript: Ll_transcript_237832
• CDS coordinates: 265-567 (+)
• Peptide sequence: MGDKSEVLEAVLKEAVDLENIPIEEVFENLRCSKEGLTSQAAEERLVIFGHNKLEEKKESKFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFV
• ORF Type: 3prime_partial

Annotations of Ll_transcript_237832

• Blastp: ATPase 11, plasma membrane-type from Arabidopsis with 90.1% of identity
• Blastx: ATPase 11, plasma membrane-type from Arabidopsis with 90.1% of identity
• Eggnog: P-type atpase(COG0474)
• Kegg: Link to kegg annotations (AT5G62670)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019437950.1)
• Pfam: Cation transporter/ATPase, N-terminus (PF00690.25)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;