Protein coding transcript 182096

• Transcript: Ll_transcript_237681
• CDS coordinates: 2310-2612 (-)
• Peptide sequence: SALQIAANPVFHERTKHIDIDCHVVREHIQNKVIHLLPISSTDQLADIFTKALSPLPFQRLLCKLGIINIHMPSLRGTINLDDANGVQEIIEESRSQALH*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_237681

• Blastp: Copia protein from Sophophora with 51.52% of identity
• Blastx: Oxysterol-binding protein-related protein 1A from Arabidopsis with 75.51% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019415358.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;