Protein coding transcript 1821

• Transcript: Ll_transcript_294546
• CDS coordinates: 38-550 (+)
• Peptide sequence: MGEEATQEHEMSIAAPLIAIFQFAYYWLDHLKKDGFDHAKETQINGEVKELLKEASSLSQPSTFAQAAKLRRLAASKEKELAKYRNLHSKDYVLYSKLLLISKYVAYIMLVLWFWRAPVAFIPRQLVQPFERLLSWRTTGPQNNNVMIGIISWLIVSARVCRFVRRAYSK*
• ORF Type: complete

Annotations of Ll_transcript_294546

• Blastp: Tail-anchored protein insertion receptor WRB from Danio with 25% of identity
• Blastx: Tail-anchored protein insertion receptor WRB from Danio with 25% of identity
• Eggnog: Required for the post-translational delivery of tail- anchored (TA) proteins to the endoplasmic reticulum. Acts as a membrane receptor for soluble get3, which recognizes and selectively binds the transmembrane domain of TA proteins in the cytosol (By similarity)(ENOG41120B0)
• Kegg: Link to kegg annotations (335756)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019420872.1)
• Pfam: CHD5-like protein (PF04420.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;