Protein coding transcript 18218

• Transcript: Ll_transcript_393229
• CDS coordinates: 367-1263 (+)
• Peptide sequence: MPSAPVPRLDGYAIQINNLFYVFAGYGSLDYVHSHVDIFNFSSNTWVERVDMPKDMAHSHLGVATDGRFIYVVSGQYGPQCRGPIARVFVLDTKTKKWNSLPPLPSPRYAPATQLWRGRLHVMGGSKENRHTPGLDHWSLAVKDGEALEKQWRTEIPIPRGGPHRACIVVNDRLLVIGGQEGDFMAKPGSPIFKCSRRLEVVYDDVYMLDDEMKWKVLPPMPKPNSHIECAWVIVNNSIIITGGTTEKHPITKRMMLVGEVFQFNLDSMVLLFSLEIGLCISFYLLKYLALFIGCCNS*
• ORF Type: complete

Annotations of Ll_transcript_393229

• Blastp: Kelch repeat-containing protein At3g27220 from Arabidopsis with 72.59% of identity
• Blastx: Kelch repeat-containing protein At3g27220 from Arabidopsis with 72.32% of identity
• Eggnog: Kelch repeat-containing F-box family protein(ENOG4110X8D)
• Kegg: Link to kegg annotations (AT3G27220)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019447444.1)
• Pfam: Galactose oxidase, central domain (PF13418.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;