Protein coding transcript 182197

• Transcript: Ll_transcript_237355
• CDS coordinates: 342-695 (+)
• Peptide sequence: MEGTGGSSASAAAPVNQWLLEFSRRFQHYLDKSTPHSTYRWIGTVGIASIYVLRVFYLQGFYIVSYGLGIYLLNLLIGFLSPLVDPELEPSDGPTLPTKGSDEFKPFIRRLPEFKFW*
• ORF Type: complete

Annotations of Ll_transcript_237355

• Blastp: Protein RER1B from Arabidopsis with 73.5% of identity
• Blastx: Protein RER1B from Arabidopsis with 69.05% of identity
• Eggnog: RER1 retention in endoplasmic reticulum 1 homolog (S. cerevisiae)(COG5249)
• Kegg: Link to kegg annotations (AT2G21600)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019413892.1)
• Pfam: Rer1 family (PF03248.12)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;