Protein coding transcript 182203

• Transcript: Ll_transcript_237346
• CDS coordinates: 342-896 (+)
• Peptide sequence: MEGTGGSSASAAAPVNQWLLEFSRRFQHYLDKSTPHSTYRWIGTVGIASIYVLRVFYLQGFYIVSYGLGIYLLNLLIGFLSPLVDPELEPSDGPTLPTKGSDEFKPFIRRLPEFKFWYSFTKALCIAFVMTFFSVFDVPVFWPILLCYWVVLFVLTMRRQIAHMVKYRYIPFNLGKQKYGGKRSS
• ORF Type: 3prime_partial

Annotations of Ll_transcript_237346

• Blastp: Protein RER1A from Arabidopsis with 76.88% of identity
• Blastx: Protein RER1A from Arabidopsis with 76.88% of identity
• Eggnog: RER1 retention in endoplasmic reticulum 1 homolog (S. cerevisiae)(COG5249)
• Kegg: Link to kegg annotations (AT4G39220)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019413892.1)
• Pfam: Rer1 family (PF03248.12)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;