Transcript | Ll_transcript_393215 |
---|---|
CDS coordinates | 1075-1464 (+) |
Peptide sequence | MNIFNIGISRYAPATQLWRGRLHVMGGSKENRHTPGLDHWSLAVKDGEALEKQWRTEIPIPRGGPHRACIVVNDRLLVIGGQEGDFMAKPGSPIFKCSRRLEVSFSLVIDNIHYLLSYIVIMVGSKDMV* |
ORF Type | complete |
Blastp | Kelch repeat-containing protein At3g27220 from Arabidopsis with 79.79% of identity |
---|---|
Blastx | Kelch repeat-containing protein At3g27220 from Arabidopsis with 79.79% of identity |
Eggnog | Kelch repeat-containing F-box family protein(ENOG4110X8D) |
Kegg | Link to kegg annotations (AT3G27220) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019447444.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer