Protein coding transcript 182312

• Transcript: Ll_transcript_238851
• CDS coordinates: 199-543 (+)
• Peptide sequence: MSWATALVRISPYTFSAIGIAVSIGVSVLGAAWGIYITGSSLIGAAIKAPRITSKNLIRLCVGIIGSSCALSDAQNSSLFVKILVIEIFGSALGLFGVIVGIIMSAQATWPTKV*
• ORF Type: complete

Annotations of Ll_transcript_238851

• Blastp: V-type proton ATPase subunit c''2 from Arabidopsis with 56.8% of identity
• Blastx: V-type proton ATPase subunit c''2 from Arabidopsis with 56.73% of identity
• Eggnog: F(1)F(0) ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation (By similarity)(COG0636)
• Kegg: Link to kegg annotations (AT2G25610)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_016196972.1)
• Pfam: ATP synthase subunit C (PF00137.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;