Protein coding transcript 182337

• Transcript: Ll_transcript_239262
• CDS coordinates: 273-689 (+)
• Peptide sequence: MGSIEDASLLERSLLQDEESKRYTGDGSVDFKGRPVLKQNTGNWRACPFILGNECCERLAYYGIATNLVTYLTRKLHEGNVSAARNVTTWQGTCYLTPLIGAVLADAYWGRYWTIAGFSIIYFIVITSGTLLFNFLGG*
• ORF Type: complete

Annotations of Ll_transcript_239262

• Blastp: Protein NRT1/ PTR FAMILY 8.3 from Arabidopsis with 74.44% of identity
• Blastx: Protein NRT1/ PTR FAMILY 8.3 from Arabidopsis with 74.44% of identity
• Eggnog: transporter(COG3104)
• Kegg: Link to kegg annotations (AT2G02040)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019448149.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;