Protein coding transcript 182344

• Transcript: Ll_transcript_239251
• CDS coordinates: 1-414 (+)
• Peptide sequence: DQFDDTDSEERIKKGSFFNWFYFILSIGGLISSTLLVWIQDNVGWGLGFGIPTLFMGLAIISFFVGTPLYRFQKPGGSFFVVAPIRKRNLIVPEDNSLLYETLNKNSAIEGSRKLKYSDELSSCYCGDNTFKACKDA*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_239251

• Blastp: Protein NRT1/ PTR FAMILY 8.3 from Arabidopsis with 69.05% of identity
• Blastx: Protein NRT1/ PTR FAMILY 8.3 from Arabidopsis with 68.5% of identity
• Eggnog: transporter(COG3104)
• Kegg: Link to kegg annotations (AT2G02040)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019459973.1)
• Pfam: POT family (PF00854.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;