Transcript | Ll_transcript_239272 |
---|---|
CDS coordinates | 1423-1980 (+) |
Peptide sequence | MCTLTLSASAPALKPAECLGSVCPPATPAQYGVFFLGLYLIALGTGGIKPCVSSFGADQFDDTDSQERIKKGSFFNWFYFSINIGAFVSSSLIVWIQENAGWGLGFGIPALFMGLAIGSFFLGTPLYRFQKPGGSPITRMCQVVVASFRKRDIVVPEDSSILYETPDKSSAIEGSRKLEHSDELR* |
ORF Type | complete |
Blastp | Protein NRT1/ PTR FAMILY 8.3 from Arabidopsis with 79.46% of identity |
---|---|
Blastx | Protein NRT1/ PTR FAMILY 8.3 from Arabidopsis with 74.26% of identity |
Eggnog | transporter(COG3104) |
Kegg | Link to kegg annotations (AT2G02040) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019464059.1) |
Pfam | POT family (PF00854.20) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer