Transcript | Ll_transcript_239277 |
---|---|
CDS coordinates | 106-525 (+) |
Peptide sequence | MGTIKDDASLVEQALLQDEESKRYTGDGSVDFKGRPVLKQNTGTWKACPFILGSECCERLAGYGIGINLVSYLTNKLHEGNVSAARTVSTWTGTYFITPLIGAVLADAYWGRYWTIAGFSIIYFIVITSGTLLFNFLGG* |
ORF Type | complete |
Blastp | Protein NRT1/ PTR FAMILY 8.3 from Arabidopsis with 66.17% of identity |
---|---|
Blastx | Protein NRT1/ PTR FAMILY 8.3 from Arabidopsis with 66.17% of identity |
Eggnog | transporter(COG3104) |
Kegg | Link to kegg annotations (AT2G02040) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019448149.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer