Protein coding transcript 182355

• Transcript: Ll_transcript_239255
• CDS coordinates: 2063-2620 (+)
• Peptide sequence: MCTLTLSASAPALKPAECLGSVCPPATPAQYGVFFLGLYLIALGTGGIKPCVSSFGADQFDDTDSQERIKKGSFFNWFYFSINIGAFVSSSLIVWIQENAGWGLGFGIPALFMGLAIGSFFLGTPLYRFQKPGGSPITRMCQVVVASFRKRDIVVPEDSSILYETPDKSSAIEGSRKLEHSDELR*
• ORF Type: complete

Annotations of Ll_transcript_239255

• Blastp: Protein NRT1/ PTR FAMILY 8.3 from Arabidopsis with 79.46% of identity
• Blastx: Protein NRT1/ PTR FAMILY 8.3 from Arabidopsis with 82.17% of identity
• Eggnog: transporter(COG3104)
• Kegg: Link to kegg annotations (AT2G02040)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019464059.1)
• Pfam: POT family (PF00854.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;