Protein coding transcript 182390

• Transcript: Ll_transcript_236568
• CDS coordinates: 219-581 (+)
• Peptide sequence: MAASKKVITRDEWEKKLNDVKIRKEDMNKLVMNFLVTEGFVEAAEKFRKESGTEPDIDLATITDRMAVKKAVQSGNVEDAIEKVNDLNPEILDTNPQLYFHLQQQRLIELIRNGKIEEALE
• ORF Type: 3prime_partial

Annotations of Ll_transcript_236568

• Blastp: Glucose-induced degradation protein 8 homolog from Dictyostelium with 66.1% of identity
• Blastx: Glucose-induced degradation protein 8 homolog from Dictyostelium with 66.1% of identity
• Eggnog: GID complex subunit 8 homolog (S. cerevisiae)(ENOG410XRG3)
• Kegg: Link to kegg annotations (DDB_G0279265)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019420259.1)
• Pfam: LisH (PF08513.10)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;