Protein coding transcript 18242

• Transcript: Ll_transcript_393243
• CDS coordinates: 154-1197 (+)
• Peptide sequence: MQLSQKYEVSNFMPQTSTTTETSPASRRTVNIPPPRQTEPVIGGKHQNKSKLSRKSGINKSIIESPNLAAVNNCRYDSSLGLLTKKFVSLIHEAKDATLDLNKSTEILQVQKRRIYDITNVLEGIGLIEKTSKNHIRWKAYDGFGQRDLDDQVTRLKAEVESLYAEEYSLDECIRKNQELLRNLQKRKNSQKYLFVTKEDILSLPCFQDQELIAIKAPQASFIEVPDPDEEFGFRQKQYKMTVRSATGPISLHLLRSKRKSNFKDGSIKQVQLIDQSWNSDHCRMRSLGLLESQDDQQNAPQSYESLSSEEFEIQEITPRDCETDDDYWFQTDPEVSLTDLWGGSNF*
• ORF Type: complete

Annotations of Ll_transcript_393243

• Blastp: Transcription factor E2FC from Arabidopsis with 54.12% of identity
• Blastx: Transcription factor E2FC from Arabidopsis with 54.12% of identity
• Eggnog: E2F transcription factor(ENOG410XNYI)
• Kegg: Link to kegg annotations (AT1G47870)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019416195.1)
• Pfam: E2F/DP family winged-helix DNA-binding domain (PF02319.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;