Transcript | Ll_transcript_236743 |
---|---|
CDS coordinates | 741-1331 (+) |
Peptide sequence | MEKVRMELEEKRKRQARMLMEAVEVGMMKKLKSKEEEIEKIEKLNYALQEKVKSLCIENQIWRDLAQTNEATANTLRTNLVQILSQARDNDGEHGGATMGAVVEEAESCCGSNDENEGWRMIGRGAQDKEVVEEGSGSRVMKNENGRLCRKCGKDESCVLILPCRHLCLCNACASSLYTCPICNSFKNATLLVNLT* |
ORF Type | complete |
Blastp | Probable BOI-related E3 ubiquitin-protein ligase 3 from Arabidopsis with 51.5% of identity |
---|---|
Blastx | Probable BOI-related E3 ubiquitin-protein ligase 3 from Arabidopsis with 51.24% of identity |
Eggnog | protein binding zinc ion binding(ENOG4111S1X) |
Kegg | Link to kegg annotations (AT3G12920) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019464916.1) |
Pfam | Zinc finger, C3HC4 type (RING finger) (PF13920.5) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer