Protein coding transcript 182482

• Transcript: Ll_transcript_238692
• CDS coordinates: 3-494 (+)
• Peptide sequence: PRSNTIAFDEDVPLFALTLINSVIELGGPSFHRHPRLLSLIQDELFCNLMQFGLSTSPLVLSMVCSIVLNLYHHLRTELKLQLEVFFSCVILRLAQSKYGASFQQQEVAMEALVDFCRQKTFTLEMYANFDCDLTCSNVFEDISNLLSKSAFPVNSPLSSMHVL
• ORF Type: internal

Annotations of Ll_transcript_238692

• Blastp: ARF guanine-nucleotide exchange factor GNOM from Arabidopsis with 84.05% of identity
• Blastx: ARF guanine-nucleotide exchange factor GNOM from Arabidopsis with 84.05% of identity
• Eggnog: and Sec7 domain(COG5307)
• Kegg: Link to kegg annotations (AT1G13980)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019455802.1)
• Pfam: Guanine nucleotide exchange factor in Golgi transport N-terminal (PF12783.6)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;