Protein coding transcript 182495

• Transcript: Ll_transcript_239208
• CDS coordinates: 3-368 (+)
• Peptide sequence: ATTMSEEKHHHLFHHKKDEEENFVESGYSEEVDYKTEEKHHKHLEHLGGIGTVAAGAYAVQEKHKAEKDPEHAHKHKREEESAAAAAGGSGGFAFHEHHDKKESKKEDEEAHGKKHHHLFS*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_239208

• Blastp: Abscisic stress-ripening protein 1 from Lycopersicon with 77.94% of identity
• Blastx: -
• Eggnog: ABA/WDS induced protein(ENOG410ZQMJ)
• Kegg: -
• CantataDB: Link to cantataDB annotations (CNT0001111)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019449765.1)
• Pfam: ABA/WDS induced protein (PF02496.15)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;