Protein coding transcript 182524

• Transcript: Ll_transcript_236397
• CDS coordinates: 124-654 (+)
• Peptide sequence: MKKEKGVMISSSVNGEEESDDKQQQQQQQQQLIRFPSRNASSKYDFVKVKVWLGDNADHYYVLSRFLLSRMLTVTKIPNHVAIKIALELKKLLTDNSLLDVSQSDLEANLFKLMERRGYAEEYINRYKMMTRFHHQRVPLVILVCGTACVGKSTIATQLAQRLNLPNVLQVSIGYV*
• ORF Type: complete

Annotations of Ll_transcript_236397

• Blastp: 2-phosphoglycerate kinase from Pyrococcus with 35.09% of identity
• Blastx: 2-phosphoglycerate kinase from Pyrococcus with 35.09% of identity
• Eggnog: 2-Phosphoglycerate kinase(COG2074)
• Kegg: Link to kegg annotations (PAB2253)
• CantataDB: Link to cantataDB annotations (CNT0002564)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019412852.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;