Protein coding transcript 1826

• Transcript: Ll_transcript_511066
• CDS coordinates: 3-1313 (+)
• Peptide sequence: GIQSTIIFPLLSYFCFSVLLSISMTIMSNSQQSKHVAVFAFPFGSHLMPLLNLVLKLAHAAPNCSFSFIGTENSNAILFPKPYIPKNIKAYSISDGVPEGHVMSSNPTEKLNLFLSTGPENLQKGIELAVAETKQRVTCIIADAFVTDSLIVAKTLNVPWIPLWLPLSCSLSCHFYTDLIRKQYANNAGNRNLDFLTGLSKLCVEDLPQDVVKGGEDETIFSKTLASLRTALPQAKAVVINFFEELDPPLHKAKTVAYVSFGTVVAPPPHEIVAVAEALEESGFPFLWSLKDNLKGLLPSGFLQRIGMLGKVVPWVPQSQVLAHDSVGVFVTHSGSNSVSESICNGVPMICRPFFGDQGIGARVVQDVWENGVIIEGRVLSKNGLLKSLNLILVQEEGKTIRENALNMKKTVQDAARPEGKSAQDFKTLVEIISES*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_511066

• Blastp: UDP-glycosyltransferase 78D2 from Arabidopsis with 41.58% of identity
• Blastx: UDP-glycosyltransferase 78D2 from Arabidopsis with 41.58% of identity
• Eggnog: Transferase(COG1819)
• Kegg: Link to kegg annotations (AT5G17050)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019435330.1)
• Pfam: UDP-glucoronosyl and UDP-glucosyl transferase (PF00201.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;