Transcript | Ll_transcript_511066 |
---|---|
CDS coordinates | 3-1313 (+) |
Peptide sequence | GIQSTIIFPLLSYFCFSVLLSISMTIMSNSQQSKHVAVFAFPFGSHLMPLLNLVLKLAHAAPNCSFSFIGTENSNAILFPKPYIPKNIKAYSISDGVPEGHVMSSNPTEKLNLFLSTGPENLQKGIELAVAETKQRVTCIIADAFVTDSLIVAKTLNVPWIPLWLPLSCSLSCHFYTDLIRKQYANNAGNRNLDFLTGLSKLCVEDLPQDVVKGGEDETIFSKTLASLRTALPQAKAVVINFFEELDPPLHKAKTVAYVSFGTVVAPPPHEIVAVAEALEESGFPFLWSLKDNLKGLLPSGFLQRIGMLGKVVPWVPQSQVLAHDSVGVFVTHSGSNSVSESICNGVPMICRPFFGDQGIGARVVQDVWENGVIIEGRVLSKNGLLKSLNLILVQEEGKTIRENALNMKKTVQDAARPEGKSAQDFKTLVEIISES* |
ORF Type | 5prime_partial |
Blastp | UDP-glycosyltransferase 78D2 from Arabidopsis with 41.58% of identity |
---|---|
Blastx | UDP-glycosyltransferase 78D2 from Arabidopsis with 41.58% of identity |
Eggnog | Transferase(COG1819) |
Kegg | Link to kegg annotations (AT5G17050) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019435330.1) |
Pfam | UDP-glucoronosyl and UDP-glucosyl transferase (PF00201.17) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer