Transcript | Ll_transcript_238233 |
---|---|
CDS coordinates | 96-1040 (+) |
Peptide sequence | MGHHSCCNQQKVKRGLWSPEEDEKLIRYIATHGYGCWSEVPEKAGLQRCGKSCRLRWINYLRPDIRRGRFTHEEEKLIISLHGVVGNRWAHIASHLPGRTDNEIKNYWNSWIKKKIRKPWVSSNSNIAKGVDNHSQFNYHSNQHDHYANYKQNNLTTKPPPVQETLFSSTCPQFMFDTSSLDHGITTLTDNNLRPELFQGSVGLSTETWNFSHNHQVHAPFTAGMDSTNYLPPLIENVESMVPFEVPSCSMNDKGEVALECLQRQELNEWVEIQQQQQCPNFLFCWDNVEGQPSGEEHAPNLSNMGTNTLPSFP* |
ORF Type | complete |
Blastp | Transcription factor MYB86 from Arabidopsis with 71.19% of identity |
---|---|
Blastx | Transcription factor MYB86 from Arabidopsis with 71.19% of identity |
Eggnog | Myblike DNAbinding domain containing protein(COG5147) |
Kegg | Link to kegg annotations (AT5G26660) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019429891.1) |
Pfam | Myb-like DNA-binding domain (PF00249.30) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer