Transcript | Ll_transcript_238887 |
---|---|
CDS coordinates | 3-449 (+) |
Peptide sequence | SLYFYLFCVCESHNAVCGRERERKSAKMSRVAVKGKKKGATFVIECAKPVEDKIMDIASLEKFLQERIKVGGKAGALGDSVTVTRDKTKITVTSDSNFSKRYLKYLTKKYLKKHNVRDWLRVIASNKDRNVYELRYFNIAENEAEEED* |
ORF Type | 5prime_partial |
Blastp | 60S ribosomal protein L22-2 from Arabidopsis with 82.26% of identity |
---|---|
Blastx | 60S ribosomal protein L22-2 from Arabidopsis with 81.74% of identity |
Eggnog | Ribosomal protein(ENOG4111UVJ) |
Kegg | Link to kegg annotations (AT3G05560) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019427766.1) |
Pfam | Ribosomal L22e protein family (PF01776.16) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer