Protein coding transcript 182696

• Transcript: Ll_transcript_238890
• CDS coordinates: 81-401 (+)
• Peptide sequence: MSRAGGAVKGKKKGATFVIECAKPVEDKIMDIASLEKFLQERIKVGGKAGALGDSVTVTRDKTKITVTSDSNFSKRYLKYLTKKYLKKHNVRDWLRVIAYNKDRNVY
• ORF Type: 3prime_partial

Annotations of Ll_transcript_238890

• Blastp: 60S ribosomal protein L22-2 from Arabidopsis with 83.33% of identity
• Blastx: 60S ribosomal protein L22-2 from Arabidopsis with 84.78% of identity
• Eggnog: Ribosomal protein(ENOG4111UVJ)
• Kegg: Link to kegg annotations (AT3G05560)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019427766.1)
• Pfam: Ribosomal L22e protein family (PF01776.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;