Protein coding transcript 18278

• Transcript: Ll_transcript_392533
• CDS coordinates: 2635-3084 (+)
• Peptide sequence: MGDASSAVAYFEESVEFLSKLPKDDLEIQHTLSVSLNKIGDLKYYDGNLQGARSYYFQSLNVRRDVIKHTSNVPAQALDVAVSLAKVADADRNLGDEKLATDGFQEAIDLLESLELNSEASRLDHRRQSVIEFLRGQLSNKQEHVEPTI*
• ORF Type: complete

Annotations of Ll_transcript_392533

• Blastp: Protein NCA1 from Arabidopsis with 68.53% of identity
• Blastx: Protein NCA1 from Arabidopsis with 54% of identity
• Eggnog: RING(ENOG411005M)
• Kegg: Link to kegg annotations (AT3G54360)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019419756.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;