Transcript | Ll_transcript_392534 |
---|---|
CDS coordinates | 2231-2680 (+) |
Peptide sequence | MGDASSAVAYFEESVEFLSKLPKDDLEIQHTLSVSLNKIGDLKYYDGNLQGARSYYFQSLNVRRDVIKHTSNVPAQALDVAVSLAKVADADRNLGDEKLATDGFQEAIDLLESLELNSEASRLDHRRQSVIEFLRGQLSNKQEHVEPTI* |
ORF Type | complete |
Blastp | Protein NCA1 from Arabidopsis with 68.53% of identity |
---|---|
Blastx | Protein NCA1 from Arabidopsis with 64.16% of identity |
Eggnog | RING(ENOG411005M) |
Kegg | Link to kegg annotations (AT3G54360) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019419756.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer