Transcript | Ll_transcript_294588 |
---|---|
CDS coordinates | 67-690 (+) |
Peptide sequence | MKPATDIHVLNNEHSKKSLINDQRSSPLIINKSSHLIRKPSSYSSKPHKQERNPIIIYMQSPKIIHTKPQDFRDLVQKLTGMTPTKKNTLDVTASLGQHQPLLEASEKFVSSLSDDSNNSIKLQEYETSSGSLTHDGETCVKEEEQYVQDNYSNILGFSDMPLFTQNSPDFPFSSRSVYKYADSPYGILGSLLSPNGLEFMKELPEY* |
ORF Type | complete |
Blastp | VQ motif-containing protein 8, chloroplastic from Arabidopsis with 51.56% of identity |
---|---|
Blastx | VQ motif-containing protein 8, chloroplastic from Arabidopsis with 51.56% of identity |
Eggnog | VQ motif(ENOG410YP72) |
Kegg | Link to kegg annotations (AT1G68450) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019418398.1) |
Pfam | VQ motif (PF05678.13) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer