Protein coding transcript 1828

• Transcript: Ll_transcript_294588
• CDS coordinates: 67-690 (+)
• Peptide sequence: MKPATDIHVLNNEHSKKSLINDQRSSPLIINKSSHLIRKPSSYSSKPHKQERNPIIIYMQSPKIIHTKPQDFRDLVQKLTGMTPTKKNTLDVTASLGQHQPLLEASEKFVSSLSDDSNNSIKLQEYETSSGSLTHDGETCVKEEEQYVQDNYSNILGFSDMPLFTQNSPDFPFSSRSVYKYADSPYGILGSLLSPNGLEFMKELPEY*
• ORF Type: complete

Annotations of Ll_transcript_294588

• Blastp: VQ motif-containing protein 8, chloroplastic from Arabidopsis with 51.56% of identity
• Blastx: VQ motif-containing protein 8, chloroplastic from Arabidopsis with 51.56% of identity
• Eggnog: VQ motif(ENOG410YP72)
• Kegg: Link to kegg annotations (AT1G68450)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019418398.1)
• Pfam: VQ motif (PF05678.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;