Protein coding transcript 182905

• Transcript: Ll_transcript_237578
• CDS coordinates: 491-1453 (+)
• Peptide sequence: MPHSDDRSIVTCAAEGQVRQAQILENGGVETKLLGKHEGRAHKLAIEPGSPHIFYTCGEDGLVQHFDLRTGAATRLFTCQPIKDRWDFRPVIHLNAITIDPRNPNLFAVAGDDEYARLYDIRKYKWDGSNEFGQPTDFFCPPHLVGDDRVGITGLAFSEQRELLLSYNDEFIYLFTQDMGLGPNPHPGSPVSPVSMNSDASEIGVSHGSEASPSHIESDDKTIPQVFKGHRNCETVKGVNFFGPKCEYVVSGSDCGRIFIWRKKDGQLIRVMEADKHVVNCIESHPHTIVLASSGIEHDIKIWTPKALQKAILPKNIEQV*
• ORF Type: complete

Annotations of Ll_transcript_237578

• Blastp: DDB1- and CUL4-associated factor 8 from Mus with 41.35% of identity
• Blastx: DDB1- and CUL4-associated factor 8 from Mus with 43.12% of identity
• Eggnog: ddb1 and cul4 associated factor(ENOG410XQZP)
• Kegg: Link to kegg annotations (98193)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019427956.1)
• Pfam: WD domain, G-beta repeat (PF00400.31)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;