Protein coding transcript 182931

• Transcript: Ll_transcript_16979
• CDS coordinates: 450-779 (+)
• Peptide sequence: MVFSSIPLYVDPPNWHQQSNQNHHQANGNGSPQMLPPLPPQASLTGGGGATVGSMRPGSMADRARLAKLPPPDTALKCPRCDSTNTKFCYFNNYSLSQPRHFCKTCRRYW
• ORF Type: 3prime_partial

Annotations of Ll_transcript_16979

• Blastp: Dof zinc finger protein DOF3.6 from Arabidopsis with 55.17% of identity
• Blastx: Dof zinc finger protein DOF5.1 from Arabidopsis with 85.71% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (AT3G55370)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019454060.1)
• Pfam: Dof domain, zinc finger (PF02701.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;