Protein coding transcript 18296

• Transcript: Ll_transcript_392567
• CDS coordinates: 3-905 (+)
• Peptide sequence: CIDFDTVRVEHSHRPFHQSICHVSSSFSTFSNNNIYNSINQPLTIPSFSLLLSLFSISFQFDSFPFFYLTRRRTMPYCDIGTLESPSPSFSAASVVSDDSQLNNDLKIFYRTYGRGPTKVLLIIGLAATHDSWGPQVIGLTGTDVPNNDTCSGDGDDDNECGGGIQACAFDNRGVGRSSAPVNKSDYSTQIMAKDAIALLDHLGWKKAHVFGHSMGAMIACKVAAMVPDRVLSLALLNVTGGGFECFPKLDRQTVSVAYRFLKAKTPEQRAAVDLDTHYSQEYLEEYVGTDKRRTILYQV*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_392567

• Blastp: Putative aminoacrylate hydrolase RutD from Methylobacterium with 30.77% of identity
• Blastx: Putative aminoacrylate hydrolase RutD from Methylobacterium with 30.77% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (Mchl_2054)
• CantataDB: Link to cantataDB annotations (CNT0001750)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019434641.1)
• Pfam: Alpha/beta hydrolase family (PF12697.6)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;